Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318895.1 | internal | 139 | 2-418(+) |
Amino Acid sequence : | |||
AARAGENMGVKGKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETVKVGSIVGWKYSDDGKEKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWT LVYDKKTEDTPEPLVFLGY | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,600.571 | ||
Theoretical pI: | 6.051 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 18.425 | ||
aromaticity | 0.086 | ||
GRAVY | -0.337 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.194 | ||
sheet | 0.187 |