Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318899.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
RNVRNFWPAVKFRYIAVGNEVSPVTGTSSFTRYLLPAMRNIQNAISSAGLRNNIKVSTSVDMTLIGNSFPPSLGSFRNDVRSFIDPIIGFLRGINSPMLVNIYPYFSYSGNPRDISLPYA LFTAPNVV | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,209.144 | ||
Theoretical pI: | 10.408 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 44.449 | ||
aromaticity | 0.125 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.367 | ||
sheet | 0.156 |