Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318900.1 | internal | 183 | 550-2(-) |
Amino Acid sequence : | |||
PICFSFKSNNGNLFPQYYYKTCPRAQEIVKSVVAKAVAKEARMAASLLRLHFHDCFVKGCDASLLLDSSRGIVTEKGSNPNKNSARGFEDIKSALEKECPQTVSCADILALAARDSTVLS GGPSWEVPLGRRDSRSASLSGSNNNIPAPNNTFNSILSKFQRQGLDLVDLVALSGSHTIGNSR | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 17,759.174 | ||
Theoretical pI: | 5.546 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 41.702 | ||
aromaticity | 0.073 | ||
GRAVY | 0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.280 | ||
sheet | 0.341 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318900.1 | 5prime_partial | 164 | 3-497(+) |
Amino Acid sequence : | |||
LEFPIVWLPDKATRSTRSSPCLWNFDRMELNVLFGAGILLLEPLKLALLESLLPNGTSQLGPPDNTVESLAASAKISAQETVWGHSFSSADLMSSNPRAEFLLGFDPFSVTIPLLLSRSK DASHPLTKQSWKWSLNNEAAIRASLATALATTDLTISCALGHVL* | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 17,759.174 | ||
Theoretical pI: | 5.546 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 41.702 | ||
aromaticity | 0.073 | ||
GRAVY | 0.149 | ||
Secondary Structure Fraction | |||
Helix | 0.323 | ||
turn | 0.280 | ||
sheet | 0.341 |