Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318919.1 | internal | 163 | 491-3(-) |
Amino Acid sequence : | |||
EKIAWGTSLPVPSVQEIVKNDAKDVPLRYIQNNDNRPLTNFKSSAQIPLINFSQLVDGDEDERKKLHLACKEWGFFQILNHGITEDVIQKVKKAVSEFFELPLIEKKKYAMEEDDLHGYG QAFVHSQEQTLEWSDIMFLVIYPLKSRKTMVWPELPGFKEAVE | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,892.383 | ||
Theoretical pI: | 5.305 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 32.181 | ||
aromaticity | 0.104 | ||
GRAVY | -0.443 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.196 | ||
sheet | 0.258 |