Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318924.1	internal	139	417-1(-)
Amino Acid sequence :
RAITQYIAHTYADKGNQLLANDPKKMAIMSIWMEVESQKFDPIASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPALNYLMGTKVKNLFDA RPHVSTWCADILARPAWSK
Physicochemical properties
Number of amino acids:		139
Molecular weight:		15,584.831
Theoretical pI:		6.467
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 23950
Instability index:		27.627
aromaticity		0.086
GRAVY		-0.204
Secondary Structure Fraction
Helix		0.302
turn		0.180
sheet		0.309