Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318924.1 | internal | 139 | 417-1(-) |
Amino Acid sequence : | |||
RAITQYIAHTYADKGNQLLANDPKKMAIMSIWMEVESQKFDPIASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPALNYLMGTKVKNLFDA RPHVSTWCADILARPAWSK | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,584.831 | ||
Theoretical pI: | 6.467 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 23950 | ||
Instability index: | 27.627 | ||
aromaticity | 0.086 | ||
GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.180 | ||
sheet | 0.309 |