Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318927.1	5prime_partial	127	2-385(+)
Amino Acid sequence :
SFRQRLYNQSGNNKPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSRGEIRKT CRKINSS*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,237.951
Theoretical pI:		9.848
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		41.972
aromaticity		0.102
GRAVY		-0.561
Secondary Structure Fraction
Helix		0.276
turn		0.299
sheet		0.213