Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318933.1 | internal | 124 | 372-1(-) |
Amino Acid sequence : | |||
VNYQANKIMGSLMAGWDSPVSDPQAMKYRKNKSLTKEEIEAYWRSKKQIEEEHQRYISMLSPQSQKQAKTIFEEAAKTEQQRLELCNVESEESLDQLIKKNGWWISSNWAHLNEPPMKEP EGAA | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,429.084 | ||
Theoretical pI: | 5.773 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33460 | ||
Instability index: | 71.173 | ||
aromaticity | 0.081 | ||
GRAVY | -1.019 | ||
Secondary Structure Fraction | |||
Helix | 0.226 | ||
turn | 0.234 | ||
sheet | 0.315 |