Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318934.1 | internal | 173 | 519-1(-) |
Amino Acid sequence : | |||
IAVATDEGKVSLGRRDIVVAWRGTIQTLEWVNDLEFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSESSRSKFNQTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVD IAFNGINKTSEGKEFPVSAFVFASPKVGDLNFQKAFSKLKHLHILRIHNLLDI | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 19,147.619 | ||
Theoretical pI: | 6.324 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
Instability index: | 33.739 | ||
aromaticity | 0.092 | ||
GRAVY | -0.007 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.231 | ||
sheet | 0.249 |