Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318940.1 | internal | 118 | 355-2(-) |
Amino Acid sequence : | |||
LGGWSSDYSAKLFGMRGRLWNLWILQTLGGVFCILLGRANTLPLAIFWMIIFSLAAQAAEGACFGIIPFISRRSLGIISGMTGAGGNFGSGLTQLIFFSSASYSTETGIIYMGIMILA | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 12,596.737 | ||
Theoretical pI: | 9.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 42.969 | ||
aromaticity | 0.136 | ||
GRAVY | 0.836 | ||
Secondary Structure Fraction | |||
Helix | 0.398 | ||
turn | 0.297 | ||
sheet | 0.280 |