Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318943.1 | internal | 128 | 384-1(-) |
Amino Acid sequence : | |||
VAEVVLYVYDMTKCGEHEAHNFTIVQMNKLLKDGVNFGGIFHTAVQIYGNDEWAYGYRNKDSGVFNCPAGKNPSYTLREKIILGRTECSPSKVSKMLKELSDSWPGNKYNIVSKNSKHFS NELLERLG | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,481.290 | ||
Theoretical pI: | 8.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 27.016 | ||
aromaticity | 0.109 | ||
GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.281 | ||
sheet | 0.211 |