Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318953.1	5prime_partial	127	2-385(+)
Amino Acid sequence :
SFRQRLYNQSGNSQPDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKNLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSRGEIRKT CRKINSS*
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,211.827
Theoretical pI:		9.778
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 6085
Instability index:		44.403
aromaticity		0.102
GRAVY		-0.594
Secondary Structure Fraction
Helix		0.268
turn		0.307
sheet		0.205