Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW318982.1 | internal | 203 | 610-2(-) |
Amino Acid sequence : | |||
GVRLLIEDYPYAVDGLEIWSAIKSWVTEYCNFYYGTAEEILTDTELQNWWKELREVGHGDKKDEPWWPEMESPEDLIDSCTIIIWTASALHAAVNFGQYPYAGYLPNRPTVSRRFMPEPG TPEYEELKTNPDKAFLKTITAQLQTLLGVSLIEILSRHTTDEIYLGQRDSAEWTKDKEPLAAFERFGKKLSDIEMRIIQMNGD | |||
Physicochemical properties | |||
Number of amino acids: | 203 | ||
Molecular weight: | 23,473.176 | ||
Theoretical pI: | 4.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 58900 59025 | ||
Instability index: | 47.191 | ||
aromaticity | 0.118 | ||
GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.197 | ||
sheet | 0.286 |