Acc_NO	ORF type	length	start-end position (strand +/-)
>GW318983.1	internal	141	423-1(-)
Amino Acid sequence :
ESRAITQYIAHTYADKGNQLLANDPKKMAIMSIWMEVESQKFDPIASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLKDSKYLGGDSFTLADLHHAPALNYLMGTKVKNLF DARPHVSAWCADILARPAWSK
Physicochemical properties
Number of amino acids:		141
Molecular weight:		15,770.997
Theoretical pI:		6.091
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 23950
Instability index:		31.175
aromaticity		0.085
GRAVY		-0.213
Secondary Structure Fraction
Helix		0.298
turn		0.184
sheet		0.319