Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319002.1	internal	196	588-1(-)
Amino Acid sequence :
GGFNWTNIRPQFDSPMFESGHFTCPKTGQTLSHTDLIPNSALMNLIAMWCREQKIPFESTGFNVNSNGVVANKTALEATRMTVSFLINKLKASQSVDSANRLVHELRVLAKTDSDSRACI AEAAALPLLVKLLGSENPSLQVNAVTTILNLSILEANKTRIMEMDGVLNGVIEVLRSGATWEAKGNAAATIFSLSG
Physicochemical properties
Number of amino acids:		196
Molecular weight:		21,134.994
Theoretical pI:		7.018
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16500 16625
Instability index:		37.336
aromaticity		0.056
GRAVY		0.039
Secondary Structure Fraction
Helix		0.291
turn		0.270
sheet		0.301