Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319007.1 | internal | 157 | 472-2(-) |
Amino Acid sequence : | |||
QNWWKELREVGHGDKKDEPWWPEMESPEDLIDSCTIIIWTASALHAAVNFGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKTNPDKAFLKTITAQLQTLLGISLIEILSRHTTDEIYLG QRDSAEWTKDQEPLAAFERFGKKLSDIENRIIQMNGD | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 18,137.173 | ||
Theoretical pI: | 4.854 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
Instability index: | 45.902 | ||
aromaticity | 0.102 | ||
GRAVY | -0.665 | ||
Secondary Structure Fraction | |||
Helix | 0.287 | ||
turn | 0.217 | ||
sheet | 0.274 |