Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319008.1 | internal | 142 | 427-2(-) |
Amino Acid sequence : | |||
LTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPA KDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,300.372 | ||
Theoretical pI: | 4.662 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 8940 | ||
Instability index: | 34.170 | ||
aromaticity | 0.106 | ||
GRAVY | 0.254 | ||
Secondary Structure Fraction | |||
Helix | 0.380 | ||
turn | 0.239 | ||
sheet | 0.204 |