Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319010.1 | internal | 199 | 599-3(-) |
Amino Acid sequence : | |||
RKSIFESLKEMFDLPLQTKIRNISNKPYHGYVGQYPQVPLYESMGIDDANIPHKAEKFTQILWPQGNPTFCETIQSYSEQLSELDKTVRRMIIESLGVENYMDEHMSSTNYLLRVMKYKG PQSSETKIGLNAHTDKNIVTILYQNQVNGLEVLTKDGQWFNVNPTPDSFTVMIGDSLYAWANGRVHSPYHRVMMTGNEA | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 22,871.675 | ||
Theoretical pI: | 6.080 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 32890 | ||
Instability index: | 46.754 | ||
aromaticity | 0.101 | ||
GRAVY | -0.550 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.261 | ||
sheet | 0.216 |