Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319015.1	internal	142	428-3(-)
Amino Acid sequence :
GKLIASVEVKCGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETIKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWTLLYEKKTEDTP EPLVFLGYALHVTKEVEDHLVK
Physicochemical properties
Number of amino acids:		142
Molecular weight:		16,143.215
Theoretical pI:		5.898
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		27960 28085
Instability index:		19.739
aromaticity		0.085
GRAVY		-0.321
Secondary Structure Fraction
Helix		0.338
turn		0.169
sheet		0.190