Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319022.1 | 3prime_partial | 177 | 531-1(-) |
Amino Acid sequence : | |||
MWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEDSRHQIFKACLRKSPLSKD IDLRALAEYTQGFSGADITEICQRACKYAIRENIEKDIERERRIKENPESMDEDDDE | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,981.258 | ||
Theoretical pI: | 4.682 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
Instability index: | 50.003 | ||
aromaticity | 0.062 | ||
GRAVY | -0.539 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.192 | ||
sheet | 0.282 |