Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319029.1 | internal | 119 | 358-2(-) |
Amino Acid sequence : | |||
FGVSGDAPKVLAYTGNEDGRKFILEGEITLDGVKSFGEKFLEDNLKPFYKSDPVPQTNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQSLEPIYNKLGKHLRGIESLVIAKMD | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,203.819 | ||
Theoretical pI: | 4.692 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 37.918 | ||
aromaticity | 0.092 | ||
GRAVY | -0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.252 | ||
sheet | 0.227 |