Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319038.1 | 3prime_partial | 118 | 354-1(-) |
Amino Acid sequence : | |||
MGENPTHNKKTGLPRKRFYRARAHSNPLSDSHFPIPISPDEVDYSLHYPEMVKADGSKKIQFADVGCGFGGLLISLAPLFPDTLMVGMELRDKVTEYVKERILGLRTTNPGQYQNISV | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,218.002 | ||
Theoretical pI: | 8.735 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 30.253 | ||
aromaticity | 0.085 | ||
GRAVY | -0.464 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.280 | ||
sheet | 0.220 |