Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319043.1 | internal | 186 | 559-2(-) |
Amino Acid sequence : | |||
EFLLIPGPKVFGDGGLLPLFQPLVHHGFYNIYTSDSSRSKFNKTSARDQVLAEVKRLVEEYKDEEVSITVTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVSAFVFASPKVGDLNFQK AFSKLKHLHILRIHNLLDIVPKYPPVGYFDVGQEIIIDTTKSPYLKLNPGDPHTRHNLEGYLHGID | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 20,657.277 | ||
Theoretical pI: | 6.539 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 38.788 | ||
aromaticity | 0.102 | ||
GRAVY | -0.180 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.263 | ||
sheet | 0.215 |