Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319047.1 | 5prime_partial | 128 | 467-81(-) |
Amino Acid sequence : | |||
RAPSKILWRTIRGMIPHKTKRGAAALARLKVYEGVPPPYDKIKRMVIPDALKVLRLQAGHKYCLLGKLSSEVGWNHYDTIKELENKRKERAQVAYERRKQLAKLRVKAEKAAEEKLGPQL AVIEPIKY* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,723.311 | ||
Theoretical pI: | 10.212 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 51.699 | ||
aromaticity | 0.063 | ||
GRAVY | -0.591 | ||
Secondary Structure Fraction | |||
Helix | 0.297 | ||
turn | 0.156 | ||
sheet | 0.313 |