Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319049.1 | internal | 137 | 413-3(-) |
Amino Acid sequence : | |||
LDENTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAVKSVVASGLARRCIVQVSYAIGVAEPLSVFVDTYKTGTIPDKDILVLIKENFDF RPGMMSINLDLLRGGNF | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 14,622.570 | ||
Theoretical pI: | 8.804 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 13.941 | ||
aromaticity | 0.088 | ||
GRAVY | 0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.285 | ||
sheet | 0.175 |