Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319057.1	internal	160	482-3(-)
Amino Acid sequence :
ANFDGFQKEAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMI AGWDEKGPGLYYVDSEGGRLKGNRFSVGSGSPYAYGVLDN
Physicochemical properties
Number of amino acids:		160
Molecular weight:		17,243.657
Theoretical pI:		9.489
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22920 23045
Instability index:		32.697
aromaticity		0.100
GRAVY		-0.108
Secondary Structure Fraction
Helix		0.294
turn		0.288
sheet		0.250