Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319058.1 | internal | 159 | 479-3(-) |
Amino Acid sequence : | |||
TLHHPSLLEPAIVKFVKERWHFSKKMMLVTLDPQQGKVACPNAIHMAWIWGNLAYPFTISKQEALWSVESWRLELVVDGIDQNLIEWMTTGKFICLYGGEDIEWIRSFTKSARSVAQRAG IDLQMMYVGKSNNKERVRRINSMITAENLSYCLMDLTSV | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,350.187 | ||
Theoretical pI: | 8.446 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44460 44585 | ||
Instability index: | 49.525 | ||
aromaticity | 0.101 | ||
GRAVY | -0.096 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.201 | ||
sheet | 0.270 |