Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319062.1 | internal | 153 | 460-2(-) |
Amino Acid sequence : | |||
VNSWPEKPAKYREVVAKYSVEVRKLTMRMLDYICEGLGLKLGYFDNELSQIQMMLTNYYPPCPDPSSTLGSGGHYDGNLITLLQQDLPGKQQLIVKDATWIAVQPIPTAFVVNLGLTLKV IANEKFEGSIHRVVTDPTRDRVSIATLIGPDYS | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,086.530 | ||
Theoretical pI: | 6.129 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 24.905 | ||
aromaticity | 0.085 | ||
GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.346 | ||
turn | 0.242 | ||
sheet | 0.229 |