Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319077.1 | internal | 194 | 583-2(-) |
Amino Acid sequence : | |||
ECTNSIKPGWFSEFSALWPGEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVI DVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 21,207.019 | ||
Theoretical pI: | 4.687 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 33.684 | ||
aromaticity | 0.124 | ||
GRAVY | 0.136 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.242 | ||
sheet | 0.222 |