Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319078.1 | internal | 134 | 403-2(-) |
Amino Acid sequence : | |||
QASILNQQGEMLQPPKFLNNYLGVGCDAEVALEIHNMREENPDKFYNQFMNKVLYAREGAKSIMDRTFADFPWQVRVEVDGIEIEVPEDAEGVLVVNIGSYMGGVDLWQNEDESYDNLDP QSMHDKMLEVVSIS | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 11,913.031 | ||
Theoretical pI: | 10.386 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 36.648 | ||
aromaticity | 0.108 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.245 | ||
sheet | 0.176 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319078.1 | 5prime_partial | 102 | 2-310(+) |
Amino Acid sequence : | |||
RNANNFQHLIMHGLRIKIIIAFIFILPQVNSTHVAPNINYKNTFCILRNLNLNAINFHSNLPWKICKRPIHDTLGSFSGIKNFIHELIVKLVRVFLPHIMDF* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,913.031 | ||
Theoretical pI: | 10.386 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 36.648 | ||
aromaticity | 0.108 | ||
GRAVY | 0.275 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.245 | ||
sheet | 0.176 |