Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319085.1 | internal | 150 | 451-2(-) |
Amino Acid sequence : | |||
KGDSATEPYIVAHNLLLAHATAVKVYKQKYQKTQEGQIGVTLVTHWFVPKIKTPLGLKAPLKALDFFLGWFLDPITYGDYPARMRANVGRRLPKFTAEQKKLVKGSIDFLGMNYYTTQYA SPMLSVPRVNLSYTTDNHVDMTAQKDGIPI | |||
Physicochemical properties | |||
Number of amino acids: | 150 | ||
Molecular weight: | 16,890.422 | ||
Theoretical pI: | 9.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24410 | ||
Instability index: | 20.049 | ||
aromaticity | 0.113 | ||
GRAVY | -0.242 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.200 | ||
sheet | 0.227 |