Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319087.1	internal	174	522-1(-)
Amino Acid sequence :
VNMQAGDHKKEPFITLNPFGQVPAFEDGDLKLFESRAITQYIAHTYADKGNQLLANDPKKMAIMSIWMEVESQKFDPIASKLTFEIVIKPMLGMVTDDAAVAENEEKLGKVLDVYESRLK DSKYLGGDSFTLADLHHAPALNYLMGTKVKNLFDARPHVSAWCADILARPAWSK
Physicochemical properties
Number of amino acids:		174
Molecular weight:		19,457.149
Theoretical pI:		5.724
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23950 23950
Instability index:		33.153
aromaticity		0.092
GRAVY		-0.243
Secondary Structure Fraction
Helix		0.299
turn		0.195
sheet		0.305