Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319090.1 | 5prime_partial | 156 | 2-472(+) |
Amino Acid sequence : | |||
DGAAFVKAAQAGYYDAIIVDSSDPIGPAKDLFERPFFEAVGKALRAGGVVCTQAESIWLHMNIIKQIMANCRQVFKGSVNYAWTTVPTYPTGVIGYMLCSTGGGPQVDFRNPVNPIDKQP SHVKSKGPLKFYNADIHKAAFILPSFARNLMESELD* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 16,027.459 | ||
Theoretical pI: | 9.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35450 | ||
Instability index: | 76.236 | ||
aromaticity | 0.131 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.299 | ||
sheet | 0.139 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319090.1 | 3prime_partial | 137 | 412-2(-) |
Amino Acid sequence : | |||
MNISIVEFQRSFGFDMRRLFVNWIDWISEVNLWSSSSRAKHITNYPSGISRNSSPSVVNRTLKDLTAVSHNLFNNIHMKPYAFSLCAYNSSCPQSLPYCLKKWPFKQIFCWTNRIRRVHY NCIIISCLCSLHKCSPI | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 16,027.459 | ||
Theoretical pI: | 9.618 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35450 | ||
Instability index: | 76.236 | ||
aromaticity | 0.131 | ||
GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.299 | ||
sheet | 0.139 |