Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319110.1 | 3prime_partial | 162 | 33-518(+) |
Amino Acid sequence : | |||
MDSGDNEVTIDLSPLLRVFKDGHVERMFGSPIVPPSLEDPTTGVASKDIDISPDIRARVYLPKLTNTTNEKLPILVYYHGGGFCLESAFSFLDHRYLNLIVSEAKVIAISVEYRLAPEHP LPIAYEDSWTALQWVVSHVLENPGFEKEPWLVNHGNFEKVLI | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,230.568 | ||
Theoretical pI: | 4.923 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 29.127 | ||
aromaticity | 0.099 | ||
GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.253 | ||
sheet | 0.253 |