Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319139.1 | internal | 153 | 461-3(-) |
Amino Acid sequence : | |||
CYIKEENMGVKGKLIASVEVKYGGHSIHDIFHMNTHHITKISPNKVQHFEVHEGETVKVGSIVGWKYSDDGKDKTCKQVIEAVDLEKKSITWKVIGGDLLELYNSFTIITSCDDHWTTWT LLYEKKTEDTPEPLVFLGYALHVTKEVEDHLVK | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 17,484.746 | ||
Theoretical pI: | 5.908 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31065 | ||
Instability index: | 19.684 | ||
aromaticity | 0.092 | ||
GRAVY | -0.370 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.170 | ||
sheet | 0.196 |