Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319153.1 | internal | 100 | 301-2(-) |
Amino Acid sequence : | |||
GFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRVTLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,933.299 | ||
Theoretical pI: | 4.419 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 33.385 | ||
aromaticity | 0.130 | ||
GRAVY | 0.211 | ||
Secondary Structure Fraction | |||
Helix | 0.390 | ||
turn | 0.200 | ||
sheet | 0.200 |