Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319154.1 | internal | 126 | 380-3(-) |
Amino Acid sequence : | |||
PGQVSEQLSELDKTVRRMIIESLGVENYMDEHMSSTNYLLRVMKYKGPQSSETKIGLNAHTDKNIVTILYQNQVNGLEVLTKDGQWFNVNPTPDSFTVMIGDSLYAWANGRMHSPYHRVM MTGNEA | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,311.036 | ||
Theoretical pI: | 5.756 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
Instability index: | 46.026 | ||
aromaticity | 0.079 | ||
GRAVY | -0.510 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.270 | ||
sheet | 0.238 |