Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319157.1	internal	157	473-3(-)
Amino Acid sequence :
VLYEGDTISGNFVVVDHDIFWNSDHPGIDFTVTSPSGNVVHTMKGTSGDKFEFKAPRSGMFNFCFHNPHSTPETVSFYIHIGHITNEHDLAKDEHLDPVNVKIAELREALESVTSEQKYL RARDSRHRLTNQSTQNRVVFYTVIEYLLLILASGLQA
Physicochemical properties
Number of amino acids:		157
Molecular weight:		17,775.639
Theoretical pI:		5.743
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 12950
Instability index:		35.365
aromaticity		0.102
GRAVY		-0.318
Secondary Structure Fraction
Helix		0.325
turn		0.236
sheet		0.197