Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319160.1	internal	125	377-3(-)
Amino Acid sequence :
VNYQANKIMGSLMAGWDSPVSDPQAMKYRKNKSLTKEEIEAYWRSKKQIEEEHQRYISMLSPQSQKQAKTIFEEAAKTEQQRLELCNVESEESLDQLIKKNGWWISSNWAHLNEPPMKEP EGAAY
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,592.257
Theoretical pI:		5.773
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34950 34950
Instability index:		70.684
aromaticity		0.088
GRAVY		-1.022
Secondary Structure Fraction
Helix		0.232
turn		0.232
sheet		0.312