Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319161.1 | internal | 182 | 1-546(+) |
Amino Acid sequence : | |||
EIQGFPTIKILRDGGKKVQEYNGPRDAAGIVAYLKKQVGPASAEIKSKEDAANLIDEKKIFVVGIFPDLSGEKFENYSALAETLRSDIDFAHTVDAKFLPRGGPVDKPTLRLLKPFDELF VDFEDFQIDAMEKFIAESSIPIVTIFDNNPENHAYVNKFFDGTNAKALLFVNFSSELDAFTS | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 20,242.652 | ||
Theoretical pI: | 4.773 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 20.719 | ||
aromaticity | 0.115 | ||
GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.220 | ||
sheet | 0.253 |