Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319166.1	internal	151	3-455(+)
Amino Acid sequence :
KLKMFIKFAIIFVFLSIKLAPFIGAVDHVTPEESILELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPLGFQPPKDGVAIPNANGAMPTFNINGVPLGTGLAGTTFAGGNNNNNNGQ TLNTQLGPDGLGLGFGTITVIDDYLTSSPEL
Physicochemical properties
Number of amino acids:		151
Molecular weight:		15,798.913
Theoretical pI:		5.104
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4470
Instability index:		39.890
aromaticity		0.086
GRAVY		0.189
Secondary Structure Fraction
Helix		0.331
turn		0.351
sheet		0.225