Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319169.1	internal	130	3-392(+)
Amino Acid sequence :
VGPVSYLLLSKPAKDVEKSFPLLTLPDKILPIYKEVIAELKAAGASWIQFDEPTLVLDLEAHKLEAFTKAYAELESSLSGLNVLVETYFADVPAEAFKTLTALKGVTAFGFDLVRGTKTL DLIKGGFPSG
Physicochemical properties
Number of amino acids:		130
Molecular weight:		14,030.120
Theoretical pI:		4.973
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11460
Instability index:		22.982
aromaticity		0.100
GRAVY		0.275
Secondary Structure Fraction
Helix		0.377
turn		0.200
sheet		0.346