Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319179.1 | 5prime_partial | 134 | 612-208(-) |
Amino Acid sequence : | |||
QVISDGNEAGNKPRINLKGYILGNAVTFRPAEQNYRIPHAHGLGLISDELYKSLESTCGGEYQYIDHTNTRCLQHVQTFNWLLSGIYFENILEPICNPVSAKARHLSPQRRYLNQKLGQL KNPTLLPGVKCRDE* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,178.055 | ||
Theoretical pI: | 8.717 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16180 | ||
Instability index: | 28.994 | ||
aromaticity | 0.082 | ||
GRAVY | -0.547 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.276 | ||
sheet | 0.224 |