Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319196.1 | internal | 175 | 526-2(-) |
Amino Acid sequence : | |||
HPTKEDRINSWPEKPPQYREVIGKYTEGVRKASLTIMELMCEGLGLEKDHFANHQLSHIQYMAINLYPKCPDPNVTAGAVEHNDGGVINLILQELGGLHVRRHKDGQRFAVEPIPGALVC INGMILKVISNGKLESGIHRVATNSVSDRISLGCLTSPACSGECIIEPAKALLSE | |||
Physicochemical properties | |||
Number of amino acids: | 175 | ||
Molecular weight: | 19,127.823 | ||
Theoretical pI: | 6.476 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11835 | ||
Instability index: | 42.215 | ||
aromaticity | 0.040 | ||
GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.269 | ||
sheet | 0.263 |