Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319201.1	5prime_partial	113	410-69(-)
Amino Acid sequence :
PDSTLDQSYAAQLRNRCPKSGGDQNLFFLDFVSPTKFDNSYFKLLLASKGLLNSDQVLTTKSQASLALVKQYAENNALFFDHFAKSMVKMGNISPLTGSSGEIRKNCRKINSS*
Physicochemical properties
Number of amino acids:		113
Molecular weight:		12,488.021
Theoretical pI:		9.406
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4595
Instability index:		40.827
aromaticity		0.097
GRAVY		-0.383
Secondary Structure Fraction
Helix		0.283
turn		0.301
sheet		0.230