Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319203.1	internal	118	355-2(-)
Amino Acid sequence :
LGGWSSDYSAKLFGMRGRLWNLWILQTLGGVFCILLGRANTLPLAIFWMIIFSLAAQAAEGACFGIIPFISRRSLGIISGMTGAGGNFGSGLTQLIFFSSASYSTETGIIYMGIMIIA
Physicochemical properties
Number of amino acids:		118
Molecular weight:		12,596.737
Theoretical pI:		9.303
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26595
Instability index:		41.336
aromaticity		0.136
GRAVY		0.842
Secondary Structure Fraction
Helix		0.398
turn		0.297
sheet		0.271