Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>GW319205.1 | internal | 120 | 362-3(-) |
Amino Acid sequence : | |||
LEMRKNAKVEKAAKTISEISSEVDRLARQVAALEAIVSKGGKVVEKDVINLTELLMNQLLQLDGIIAEGDIKVQRKNQVRKVQKCVETLDVLKIRNSTPIKNGNQNPKDQSPPAHQRRDY | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,454.404 | ||
Theoretical pI: | 9.587 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 21.950 | ||
aromaticity | 0.008 | ||
GRAVY | -0.595 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.192 | ||
sheet | 0.258 |