Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319218.1	internal	129	1-387(+)
Amino Acid sequence :
PTIKGINFDLPHVVQDAPSYPGVEHVGGDMFESVPEGDAIFMKWILHDWSDGHCLKLLKNCYKALPDNGKVIVVEAHLPVKPDTDTAVAGVSQCDLIMMAQNPGGKERSEQQFRALASDS GFKGLNLIW
Physicochemical properties
Number of amino acids:		129
Molecular weight:		14,114.980
Theoretical pI:		5.188
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19605
Instability index:		26.059
aromaticity		0.078
GRAVY		-0.171
Secondary Structure Fraction
Helix		0.302
turn		0.256
sheet		0.233