Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319219.1	internal	175	526-2(-)
Amino Acid sequence :
GEAFSLKIEKLLFQGKSDYQDVMLFESATYGKVLTLDGAIQHTENGGFPYTEMIVHLPLGSIPSPKKVLIIGGGIGFTLFEVSRYSTIEKIDIVEIDDVVIDVSRKYFPYLAAGFDDPRV TLIVGDGAAFVKAAQPGYYDAIIVDSSDPIGPAKDLFERPFFEAVAKTLRPGGVV
Physicochemical properties
Number of amino acids:		175
Molecular weight:		19,025.595
Theoretical pI:		4.712
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11920 11920
Instability index:		30.497
aromaticity		0.114
GRAVY		0.178
Secondary Structure Fraction
Helix		0.377
turn		0.229
sheet		0.223