Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319222.1	internal	163	1-489(+)
Amino Acid sequence :
SPLIMSCYKGKYADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGCLQYLSGVILFEETLYQKTAAGKPFVDVMKEGGVLPGIKVDKGTVELPGTNG ETTTQGLDGLAERCAKYYEAGARFAKWRAVLKIGANEPSQLAI
Physicochemical properties
Number of amino acids:		163
Molecular weight:		10,935.329
Theoretical pI:		8.010
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		25.932
aromaticity		0.050
GRAVY		-0.268
Secondary Structure Fraction
Helix		0.300
turn		0.270
sheet		0.220

Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319222.1	5prime_partial	100	489-187(-)
Amino Acid sequence :
DGELRWLIGTNLEHSTPLGEPSTSLIVLCTTLSKSIKTLRGGLTIGSGELNGTLVNLNTRKDSTFLHDIDKRFTSSGFLVKCFLEQDNTTKVLKTPRGTE*
Physicochemical properties
Number of amino acids:		100
Molecular weight:		10,935.329
Theoretical pI:		8.010
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		25.932
aromaticity		0.050
GRAVY		-0.268
Secondary Structure Fraction
Helix		0.300
turn		0.270
sheet		0.220