Acc_NO	ORF type	length	start-end position (strand +/-)
>GW319224.1	internal	153	1-459(+)
Amino Acid sequence :
PPGQVWNVPTGRRDGIISNASEALANIPPPTSNFSGLQTSFASKGLDLKDLVLLSGAHTIGVSHCPSFSSRLYNFTGVWGKQDPSLDGEYAANLKMKKCKSINDNTTIVEMDPGSASKFD LGYYKLVLKRRGLFQSDAALTTSATTKSYINHL
Physicochemical properties
Number of amino acids:		153
Molecular weight:		16,496.469
Theoretical pI:		9.147
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		18450 18575
Instability index:		36.285
aromaticity		0.085
GRAVY		-0.297
Secondary Structure Fraction
Helix		0.281
turn		0.320
sheet		0.209